DPCstruct | MC63180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 180 ± 14 aa |
| Standard deviation of domain lengths | 14.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091C191 | 1-159 | MIIILPALLDLRSNGEELTQITNLKTDATGPLDFFIKNMIGVYDTTKYGSIPFIYIGLLPLAFFVFYFIIKEIPWKEKLLYALLIAL… |
| F9P9F8 | 199-389 | SLIMILPTFLDLKTHGEKLTKVTTLLTEKSWYLDIFAKNFIGAFDTTKYGSIPMIYVGLIPLLLAVLFFTLRSIKFHVKLAYFLLIT… |
| A0A414SA54 | 122-314 | None |
| A0A7X1Q7N4 | 77-242 | None |
| A0A1Y0VPC1 | 91-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.