DPCstruct | MC6318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 148 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q3A6G3 | 274-411 | SNYFYSTTIAGLVFHGVLGSAGPYILGEDGSIEIGVCSIIYLENEDNETPKGYYIAKYGDSWQTSIYLKGFNESDINTLTAEFGIPR… |
| A0A1M5NW33 | 1-143 | MSMRFYLVDLGEMQFEGMLSQDGPHIKQLGGSSLAIGEAALHYGDPMDPGWRLVSPHQAIPLTPLDESQVLELATHFGLPMRTAPNE… |
| C5B3H5 | 535-677 | None |
| C6XEP8 | 93-245 | None |
| A0A7V8EEN9 | 1-148 | None |
| R0CM49 | 1-158 | None |
| A0A833LSR5 | 103-262 | None |
| A0A7X1L115 | 37-182 | None |
| A0A177ING1 | 280-422 | None |
| Q1LA87 | 381-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.