DPCstruct | MC63177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 74 ± 17 aa |
| Standard deviation of domain lengths | 17.32 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J1FGV9 | 2-64 | ARTIATRWITLGTEVHESTGKMVEKYNVENLELEAGGGEYPNQDGFGWTNGVFLKLISLYPEL |
| A0A482SBS2 | 4-54 | CYSAYSETGYMYEKYDALVFGHGGGGGEYVPQVGFGWSNAVALVLIDQAAS |
| A0A7W0WNA4 | 10-77 | None |
| J9ARV4 | 7-82 | None |
| J9E6F9 | 128-210 | None |
| J9EE49 | 9-82 | None |
| Q1NGR5 | 66-128 | None |
| A0A0D8Y605 | 2-62 | None |
| A0A7R9DJZ6 | 11-78 | None |
| A0A182TBV1 | 88-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.