DPCstruct | MC63172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 424 ± 61 aa |
| Standard deviation of domain lengths | 61.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8QUJ5 | 2-406 | GIDFDINQRTREVVSELKKDPTFKDYKFFTLITYEYMGRTMFLMLEDPQDGELRLTIPIHQFILLCSTEEWHNLSLWKFAKAYELFS… |
| A0A3D4Y4S7 | 1-441 | MLIDLYDIWENKIDFKEQISVANEGIIDRIYSLFEMDRSRSCSIFAPAMIFPEQKYDSSQRTYTFIAKASRGVVVALNADEYEEGQL… |
| A0A089MD30 | 1-314 | None |
| C0ESX9 | 355-751 | None |
| A0A261KN42 | 1-512 | None |
| A0A0E3X076 | 309-711 | None |
| A0A494VQ03 | 359-851 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.