DPCstruct | MC63171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 118 ± 20 aa |
| Standard deviation of domain lengths | 19.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H2Y620 | 8-120 | QHQYFLSYSELVANFPSPEKVVSDYIKHKFSTTLPWFGWADPDNLYFIRFTQSRSNNKSYTGWDHLGKYAIETLTLTQAAIVNIGSR… |
| A0A380Q729 | 1-146 | MKNQWQHQYFLSYSELVANFPSPEKVVSDYIKHKFSTTLPWFGWADPDNLYFIRFTQSRSNNKSYTGWDHLGKYAIETLTLTQAAIV… |
| A0A0N9JNY6 | 1-143 | None |
| A0A0N8RFK1 | 1-106 | None |
| A0A4R3W9C2 | 11-103 | None |
| A0A3M4ZHQ9 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.