DPCstruct | MC6317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 210 |
|---|---|
| Mean domain length (aa) | 110 ± 16 aa |
| Standard deviation of domain lengths | 15.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09458 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0BXB0 | 17-123 | ELNHNLGFEYGVDDNRYYKKYNNGLLEMWGSVVIDKSSGYGTITFPMDYANKAFRVFATQCYNSSAVPVMICSAQQQSTSTCIIYGR… |
| A0A844KC74 | 1-98 | MKKYADGRFEAYGHVAITDLVFANQIGTSSVYYAQYQNLNIGITAKTISSVQHTANNSGVVWTGNASVSGIAMKGTILQYGSTSRST… |
| A0A1J0ERA1 | 452-555 | None |
| A0A2W1V9Y8 | 137-258 | None |
| A0A5M8P5W6 | 48-174 | None |
| A0A7C3MPG5 | 2-121 | None |
| A0A4P5NLN7 | 189-292 | None |
| L0DII0 | 18-105 | None |
| A0A6L9GPZ1 | 305-420 | None |
| A0A4D8Q5X2 | 196-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.