DPCstruct | MC63168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 635 |
|---|---|
| Mean domain length (aa) | 152 ± 31 aa |
| Standard deviation of domain lengths | 30.66 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.98 |
| Pfam Score | 98.79 |
| Assigned Pfam label(s) | CL0023- PF20131- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2DMB5 | 1-164 | MLVSFGAKNFASFKEGFDISFRFGNACPEQISQGKSISNIICVKGANGAGKTNILKALNFISSFISRSFDIKPDSHILFDSYFSSIT… |
| A0A101X6K8 | 1-133 | MITRVEVENFRSIVKGKAIITEGINFIHGPNGAGKTSLLEAIAIALYGSEWVRGRYRLGDLVRRGASSSVIRVEYVGIDGRRYLVQR… |
| A0A524RR97 | 23-197 | None |
| A0A0B8NLC1 | 1-99 | None |
| A0A1W9WY55 | 2-122 | None |
| A0A837Q1S9 | 6-174 | None |
| R6VK16 | 317-470 | None |
| A0A1I5XR42 | 2-130 | None |
| A0A1Q6K9B6 | 1-132 | None |
| I1CDT8 | 60-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.