DPCstruct | MC63160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 9.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2RT29 | 1-98 | MIVDLPDTTTSKISKKITSLREQGGVIALGRVLTLVVVTKSGLEEEAIEAANEASREHPCRIIVLADAGSEAPNRLDAQIRVGGDAG… |
| A0A829PRJ4 | 1-118 | MIIDLPNTTTNDVNKKLVELRETGGAVTMARVLTLVVITDAGDDVEEVIEAANGASHEHPCRVIVLERNPLASDTGLSAQIRVGAMP… |
| X7YPF1 | 137-238 | None |
| A0A3B8UEW0 | 1-110 | None |
| A0A537WUV8 | 2-116 | None |
| A0A1Q7WZ14 | 3-131 | None |
| A0A538HJA6 | 195-319 | None |
| A0A0L0KJS5 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.