DPCstruct | MC6316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 158 ± 23 aa |
| Standard deviation of domain lengths | 22.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518A6J4 | 97-262 | YVPGQPNEHDHDPKEIELCEKLSAAMAWTLKGVEVNVSEGSSPFDPFYVAVNRGAERPTKITVPLIRSAFNGAIYPQAKLRIAPLNE… |
| A0A137PFL5 | 37-191 | NSNFSQLSDNHISVVNKLGELSSNVFYESESDYPLVPFHFSLKEFDTVDDGSDLTPEKFLELVQTVNSAKKVLEDKSATVQDIELSQ… |
| A0A5C3MGV1 | 5-141 | None |
| A0A4Y7TVJ6 | 13-158 | None |
| A0A3N4IJE0 | 33-231 | None |
| A0A426UA49 | 203-342 | None |
| G4TBY5 | 27-198 | None |
| A0A2G7GV23 | 49-194 | None |
| E4ZPC7 | 58-234 | None |
| A0A812S5T1 | 71-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.