DPCstruct | MC63151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 180 ± 6 aa |
| Standard deviation of domain lengths | 5.96 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10564 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0VMS3 | 84-265 | RYAKGKENQDADMWRCFDDRSIVSSNRSVSCVDDCGNAIPCLGEVKSITVVHTTRHAEIQSLVARESARLCPSSQKAANAYCKTQQA… |
| D3GBB9 | 1-181 | MELDRICTMQNGGVTSCAQCEANPVRTCRCYNIFQHDYTSNDGGCINNCGQIIPCVGAVVQKEYIHEIKAATLNSLIRKNCGMSYDF… |
| F0VMS0 | 86-278 | None |
| A0A0F7U3W1 | 156-330 | None |
| A0A2C6L209 | 151-323 | None |
| A0A151HGM9 | 389-562 | None |
| H9BC57 | 84-262 | None |
| A0A2A9MNY4 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.