DPCstruct | MC6314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 199 ± 30 aa |
| Standard deviation of domain lengths | 30.33 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146HTU0 | 5-178 | CYTDPSVEGCRSFRRGHMDIVADRDSLCAAMDFMVGCTLSHECTNGTTNANSTYCKPWSLVGDLCLDMPGMDGCEAWNALCGKGVAN… |
| A0A137PAS3 | 17-218 | LCDLSSCLKNTNSTDCADIVISDNDINNSLTSICGNNTNLVGCSLWKKCQQSKVTRPYCSGYSVLYDVCTIDPVSDSMCGTVNALCA… |
| D3BMA4 | 18-221 | None |
| L1JSC9 | 10-209 | None |
| A0A835Y3J7 | 415-572 | None |
| F4PZ12 | 1-204 | None |
| A0A1S8VY97 | 113-326 | None |
| A0A1S8VZH4 | 113-326 | None |
| A0A1Y2H9U7 | 2-230 | None |
| A0A7J7QFP8 | 72-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.