DPCstruct | MC6313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S8A1M5 | 748-848 | GGGGPHGPSTFDKMKLGFMMGTSVGLIIGFIFGGFNIFRYGAGPNGVFRSLGQYMAGSAATFGFFMSIGTAIRTQPYDQRSTYAFAQ… |
| A0A137P692 | 2-93 | SQEPSYFDRMKMGFVMGGVVGGCMGFVIGSFTVLNYGPGPGGYMRTIGRHMLNSGGMFSVIMSFGSLIRNEEQFKLQNNIYKRNYPV… |
| A0A3M7MCL0 | 35-124 | None |
| V2X594 | 1-83 | None |
| X8JVG7 | 1-72 | None |
| A0A4P9XAP6 | 4-112 | None |
| A0A0D2I7Y9 | 1-82 | None |
| A0A098VRB0 | 4-77 | None |
| A0A5N6KH04 | 60-147 | None |
| A0A2V1BPN1 | 4-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.