DPCstruct | MC63129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 7.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 39.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6NJH1 | 2-107 | LKSYCLNSVASRHNMDDLSEHYLGYTTTHFTDIAGKGKKQITFNQVSIDDGAPYACEDVIVTHKLNEVLAQELVNYATLYKLYQTLE… |
| A0A377LQE1 | 180-284 | LESYILDSVAGRHDMDSLSDRWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLKMWPKLQKHEGPLNVFQNIE… |
| A0A0G1NIM0 | 449-553 | None |
| A0A1E3H7I1 | 184-288 | None |
| A0A832NLT4 | 324-429 | None |
| A0A5B5VW15 | 72-175 | None |
| A0A5A7MSX5 | 1-106 | None |
| A0A7R9RC42 | 30-134 | None |
| A0A7Z9IPB6 | 4-89 | None |
| A0A447J974 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.