DPCstruct | MC63127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 328 ± 87 aa |
| Standard deviation of domain lengths | 86.52 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 92.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.35 |
| Pfam Score | 93.41 |
| Assigned Pfam label(s) | PF05681- PF05683 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6NJ15 | 2-304 | KIQQKHVIESVANALQYISYYHSPDFIQAMVSAHEKETHQSAKNAIAQILINSKMSAIGQRPMCQDTGIVNVFVEVGMDVWEADLSL… |
| A0A1I8JM47 | 68-339 | HVDGKALTLLAQTAMVDIAHLLRPGHLQSLANILKDSEASKNDKFVALELLKNANIAANMVLPGCQDTGTAIVIGKKGQYVMTHCAD… |
| A0A388NRQ0 | 46-337 | None |
| A0A350M0A9 | 9-276 | None |
| A0A4R9LS92 | 1-367 | None |
| A0A7H1NR15 | 649-1137 | None |
| A0A800C9S1 | 3-239 | None |
| A0A1J1H7C8 | 114-587 | None |
| A0A447U3P8 | 1-193 | None |
| A0A654HEF7 | 290-661 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.