DPCstruct | MC63125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 114 ± 23 aa |
| Standard deviation of domain lengths | 22.90 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6NLP7 | 16-124 | NDKKLQDWDTPNQEQINKLKAESQKTKPQLANHDHQVLIQTEPDDNVKDSTLKLALKHPAQTTIVQMQKDGTYRVVYGTDLDKITGR… |
| A0A5E6NE67 | 14-111 | LQQWEKFTVPDTHEVSPFSKNTYHVFVQLEDDSVIAEVQQPGGKHFTNSTLIQMDKEGNYLVVHGLSLSEIPEASDIKLVFNGHGND… |
| E0WUJ8 | 30-152 | None |
| A0A5E6NRP8 | 170-280 | None |
| A0A5E6NND5 | 221-322 | None |
| A0A5E6NLQ7 | 600-719 | None |
| A0A5E6NEG6 | 34-145 | None |
| A0A5E6NEA6 | 278-372 | None |
| A0A5E6NC66 | 98-207 | None |
| A0A5E6N549 | 16-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.