DPCstruct | MC63121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 68 ± 16 aa |
| Standard deviation of domain lengths | 16.39 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 88.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6N2L9 | 78-133 | GFVINGKVAGDQSGYSVSSAGDVNGDGLDDLIVGAPFADLSGKSNAGKSYVVFGKA |
| A0A845ZVT9 | 16-81 | GFSINGVTLGDRSGFSVSSAGDINGDGNHDLIIGAPGADPNGLFSGTSYVVFGGPDVGTTGTIELA |
| A0A5E6NU76 | 7-64 | None |
| A0A2M6VRH2 | 5-59 | None |
| A0A5C7X129 | 1-82 | None |
| A0A1I1WH11 | 328-380 | None |
| A0A3B1B485 | 47-96 | None |
| A0A1H3UF89 | 57-111 | None |
| A0A2M7CTA1 | 51-104 | None |
| A0A5E6N3F6 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.