DPCstruct | MC63120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 188 ± 27 aa |
| Standard deviation of domain lengths | 26.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6N2D1 | 2-180 | ITSAIQQIVNTDRTELKDFFSEVDKLHKTDEAVTAKIANNPKLAKALTDPNLTPTQKQQLATELVSSVMVELGYTQAVDIKLVADSQ… |
| A0A0V8QIL0 | 63-228 | IFNRSEDELTIDFNVDEVLQGILHKFSLENWQEMKDADKLSAIKELAQAVGEKLGLDKIPKIEIFDGENEPYGNFDPLLNVVNLNKQ… |
| A0A519G2P9 | 371-557 | None |
| A0A7T9H2C2 | 120-317 | None |
| A0A7J3WZS7 | 314-484 | None |
| A0A4R3KRU9 | 35-290 | None |
| A0A0P8A1P0 | 499-686 | None |
| A0A0P7X819 | 288-472 | None |
| A0A7T9Q8V0 | 365-539 | None |
| A0A1C5SC69 | 108-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.