DPCstruct | MC6312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 69 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A137P3M3 | 1-71 | MVWLNDLELFIKESLSLTEQHPDKTRLSYKYRAVDGKLIVKVTNDTITLKFATDQMQDLKRLEKLVKSAMY |
| A0A5F4CTJ1 | 1-49 | MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGSLCIKVTDDLVDH |
| A0A445JPB8 | 68-140 | None |
| A0A4W4DYC8 | 54-121 | None |
| A0A0E0HNM9 | 104-187 | None |
| A0A2I4AJ22 | 1-61 | None |
| A0A7E4W1T0 | 29-96 | None |
| A0A7J6PV45 | 1-74 | None |
| A0A5B6W4R2 | 1-46 | None |
| A0A7R9KS31 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.