DPCstruct | MC63119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 126 ± 24 aa |
| Standard deviation of domain lengths | 23.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 44.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0592- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6N1L4 | 1-157 | MNGEVTGGESGASVSSAGDVNGDGLDDLIVGAKYANPNGHDSGKSYVIFGKTDTNAIDLAKLGGNPKHTIDYLGDKNANTFTGASRD… |
| A0A1I1WH11 | 341-442 | SGYSVSGAGDFNGDGFADLIISAPYADPSGSSSGSSYVVFGNNFTAAVTFLGRTENDSFVAGTSLAERFVAGNGNDTMVGGGGADVF… |
| A0A5E6NU76 | 1-143 | None |
| A0A2V3W583 | 699-803 | None |
| A4CUX5 | 199-298 | None |
| A0A1Y2R222 | 647-792 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.