DPCstruct | MC63118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 97.14 |
| Assigned Pfam label(s) | CL0548- PF16200- PF06961 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E5QNR2 | 47-111 | QPIGVITGTSSKGEGVQIKDFGSFVVRRRAACTGRNLQTGASIQIVASKVVAFKVSKAFEDAVNG |
| A0A292ZKA0 | 2-58 | SAALERGENVKISSFGTFVLRDKTQRMGRNPKTGVEVPIEPRRVLTFRASQTMRDRV |
| A0A559SQ19 | 103-167 | None |
| A0A1M7HPZ8 | 24-91 | None |
| A0A858ARV1 | 175-237 | None |
| A0A822MV69 | 101-165 | None |
| A0A1Q6UK86 | 43-114 | None |
| A0A3C0CG65 | 22-96 | None |
| A0A3E1D9F9 | 82-145 | None |
| D6BE89 | 35-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.