DPCstruct | MC63114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 288 ± 47 aa |
| Standard deviation of domain lengths | 46.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A160TFL8 | 70-350 | EIDVAFGSNILNMDNGELRALSALPDELGAAGMPMSRIALLYALGYEDTLREDGSIPDEMAERGAGEFFALMKAQSVSGQLFGRLIL… |
| A0A519Q482 | 203-514 | GLWATWVSWQKGSRKLLKRIAQGIGMVFHADFIQGAWFSALLDFELYMMTRHEFDPEPIDAEGAEMPQKSIMNYGFLLYAIPLLAPE… |
| A0A1H0Y9Z3 | 486-854 | None |
| A0A1Q9MT76 | 36-250 | None |
| A0A4V1URN8 | 494-848 | None |
| A0A0F9QCP8 | 517-772 | None |
| A0A529UMJ1 | 74-417 | None |
| W2CGD7 | 104-354 | None |
| A0A844S775 | 1-284 | None |
| A0A4R7D2S7 | 574-902 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.