DPCstruct | MC63112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 407 ± 123 aa |
| Standard deviation of domain lengths | 123.07 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 77.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9U2P4 | 113-504 | LVSGNEKIDGFIKEMQLNSKNDLLFKWIPYGQFSKIKEISKNNSITIYSAVWTDGGLLQFENYYSEDMEDLDEEVALKLFHSSQDPI… |
| A0A397W3K2 | 43-386 | KRNGKCANCNRFNTSYSWCQTCDPQKTTRGWTSGNTDVDDCIKKFQHKATSYNDVIEWIPYDRLENVQKIGDKFLATWLDGICRTGY… |
| U9UQK4 | 12-413 | None |
| U9UJI2 | 115-718 | None |
| U9UCC0 | 16-260 | None |
| U9U819 | 5-390 | None |
| U9U678 | 1-305 | None |
| U9U5P0 | 15-287 | None |
| A0A397INM5 | 114-456 | None |
| U9SL83 | 4-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.