DPCstruct | MC63111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 228 ± 47 aa |
| Standard deviation of domain lengths | 47.10 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.81 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0023- CL0106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9TVH5 | 37-248 | IQSPLISSSLIIQQKRTGTAKPKYKTPKEKQVKTLGFKQKKTKKESSRDVEIASTSSSGRGGEEFYKPAPDVILNDMFPEVFTNENV… |
| A0A3P3Z0N6 | 28-242 | AHPPEIHPTNLSFNDIDSMYCLGNDELIKYFPEGVGGKVMQLMPPSHPRGFLYRKQSHLLNCFIDKLPFWQSKERALRSLTNGRPGF… |
| F0WVD8 | 32-268 | None |
| A0A2S5BBR5 | 244-465 | None |
| A0A1Y3BUX9 | 1-130 | None |
| K8F299 | 45-313 | None |
| A0A7N2KNM0 | 5-314 | None |
| A0A226F039 | 33-183 | None |
| A0A433QH74 | 38-247 | None |
| A0A7J6UC86 | 36-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.