DPCstruct | MC63107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 161 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9TB74 | 5-161 | NEQGNKEMARRKELRFHVGFFKSYIQLQAFCEINLNRKQSETTKSQAKILIAQFYPLISLPNLELMLQRAPRIYRLLEVANFDWRLL… |
| A0A372QGQ6 | 122-273 | LEKHIETEIRRRRKFRGYINFLMIYQKIEVYCNLYKTRARGETIKNQMNKKIIEYSSSSKFKTQDISIFIKTGKRIEKLISLSNREW… |
| A0A2Z6R9W1 | 127-285 | None |
| A0A2H5T286 | 376-541 | None |
| A0A2Z6RC77 | 272-464 | None |
| A0A2Z6QMH4 | 204-351 | None |
| A0A2N0NQU0 | 311-468 | None |
| A0A2P4P8S1 | 439-595 | None |
| A0A2H5UBQ3 | 160-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.