DPCstruct | MC63105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 111 ± 20 aa |
| Standard deviation of domain lengths | 19.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0735 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G5T1L4 | 24-132 | TDFGSVIPGRGERDGMSVDEKTVRRIAHLARIAVTDDEVGPLQGELNAILAFVEQLGTVDVASVEPMTSVTPMAMKKREDVVTEGGR… |
| A0A2S6DA17 | 2-78 | ANLARLQISPEETEEKANTLESIFDFAKQNDIADTEGVEPTYHDLDLQNVLRKDKAIKGIPQELPLKNAKETADGHF |
| A0A7R9B1T0 | 24-153 | None |
| A0A7J7IQC7 | 65-178 | None |
| A0A847Z5P0 | 2-94 | None |
| A0A239BDW2 | 8-104 | None |
| A0A0G0I2D1 | 2-90 | None |
| A0A800BQK8 | 184-288 | None |
| A0A835R2L7 | 1-127 | None |
| A0A388LGL0 | 145-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.