DPCstruct | MC6310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 180 |
|---|---|
| Mean domain length (aa) | 279 ± 64 aa |
| Standard deviation of domain lengths | 63.79 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.57 |
| Pfam Score | 79.89 |
| Assigned Pfam label(s) | CL0257- PF21183- PF21184- CL0010- CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1BH38 | 104-330 | NQDSFIDSVKTDHVQFKPIGEKIHEYTREVKHGNEYFEIYKSSFSSQKFREYHARMKIFVLLFIEGGSYIEDDDEKWEIFTIFKREG… |
| A0A137NXI3 | 75-378 | QPAKPPANTPIIPIEPSLSHKKTFKEIPSPYSTSIKSCVFDRVEIDTPSQSFYPSALVTGNKVHICEICFKYFNDFGTLVHHRTNCS… |
| A0A7E5WXR2 | 2-180 | None |
| A0A162PKL5 | 197-471 | None |
| S4RP37 | 70-339 | None |
| A0A368FEP8 | 37-300 | None |
| A0A1S8VW73 | 4-237 | None |
| A0A5J5C8D2 | 2-262 | None |
| A0A3P7DDZ1 | 32-259 | None |
| H2B2C1 | 131-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.