DPCstruct | MC631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 183 ± 21 aa |
| Standard deviation of domain lengths | 20.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04222 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379U6M9 | 6-161 | IHLRLERLESWQHVTFMACLCERMYPNYAMFCKQTEFGDGQIYRRILDLIWETLTVKDAKVNFDSQLEKFEEAIPAADDYDLYGVYP… |
| A0A0B4D5M3 | 3-174 | IDSFPAYLATLERAIERLSPPARLAFAAWCARRLFAAHADDLPDAAARTGAAEALTFVERRTAADTDEAASIDAALLRLQTIDVDQI… |
| A0A7J9Y2H7 | 33-231 | None |
| A0A800IDU7 | 146-330 | None |
| A0A6P1AK82 | 1-197 | None |
| A0A563VQ68 | 11-237 | None |
| A0A1E5QGN1 | 12-146 | None |
| A0A7C4QUF7 | 7-194 | None |
| A0A1V0TJQ8 | 22-192 | None |
| A0A534U3C3 | 42-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.