DPCstruct | MC63095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 236 ± 38 aa |
| Standard deviation of domain lengths | 37.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3CFL2 | 33-282 | LRLSLLGSHDEVANVGFPYFGGEGSEHFNKVDLENILLHKLPAKRLQLADGSTALVTTVYDLTMANYGLERGLNDDNCAAGYDEVKA… |
| A0A4P0Y874 | 304-590 | LQLSLLGSQDEIAEVGFPYFGGDGTEHFNKVELENVLLHKLPVKRLQLADGSTALVTTVYDLTLANYGLERGLNDVNCATSYDDVKA… |
| A0A378B0J9 | 1-292 | None |
| A0A1I4E861 | 428-691 | None |
| A0A380FN20 | 67-302 | None |
| A0A017HEE1 | 5-225 | None |
| A0A4P0VCX7 | 379-631 | None |
| A0A378F4Z1 | 2-222 | None |
| X7YBV1 | 338-599 | None |
| A0A7G1I7E4 | 194-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.