DPCstruct | MC6309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0SRV1 | 4-65 | RKVIEMAKNRPKGYGRRIGAVRGRSQMQTPSGHWVKRDTETGRFMEIKTSDTKPFKGIRKEK |
| A0A1U7GSK6 | 30-83 | MAKNTGKGYRRGAVDNRSQTYNPVTEQWVKRDAETGRFMDVKQNGEPFKGVRKE |
| F6GAZ1 | 69-129 | None |
| A0A5S3S791 | 32-90 | None |
| A0A6F9ZDF3 | 1-49 | None |
| A0A1E7XI32 | 1-52 | None |
| A0A7Z0QK26 | 22-93 | None |
| I0X6E9 | 286-340 | None |
| A0A2J0LGF0 | 1-51 | None |
| A0A512JBA0 | 15-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.