DPCstruct | MC63070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Standard deviation of domain lengths | 18.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.32 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0004- PF10102 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4I561 | 116-214 | WNYRKQIVINGSTSGLTDYPVNMAINWTGGMDSAFKDLRFTYYDKTVGLQKEIPYWIENYTASANATVWIKANLTTGNNTVYMYYGN… |
| A0A256ZTT5 | 247-366 | WLQGWQYRKSIYITNNIASDLNNYQVKIELNSTNFDFTKANSDGSDLRFTLEDGITLIPYWIQEWNSANQRAIIWIKVPQILANSIT… |
| A0A0G1JQY5 | 71-178 | None |
| A0A5E4KQF5 | 345-458 | None |
| A0A1V5XCV7 | 150-287 | None |
| A0A7X7JP51 | 260-377 | None |
| A0A662PW46 | 71-194 | None |
| A0A7J2SFW4 | 8-138 | None |
| A0A6P8ID89 | 102-247 | None |
| A0A7J4J8F4 | 168-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.