DPCstruct | MC6307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485M6F1 | 10-94 | KEKALSRVRSIWGNKNEFERYTVFLEHEWDYSGRFRICLKLSDNPDHPQGLSHFTFCKEGEHLGEKLDFDKLPEDIQEHIISRIN |
| A0A662C5U1 | 2-75 | QIKAIYDNKGETCDRYSIVFKEKEGDYNIHLGLSNEPTHPQGFSQWSQCVDGDHLGTKIDFSELPINIQEHILK |
| A0A178IPW5 | 26-126 | None |
| A0A845Q8B3 | 11-84 | None |
| A0A497C1H0 | 5-83 | None |
| A0A352E0E5 | 1-80 | None |
| A0A1V5NWR2 | 10-97 | None |
| A0A5C7P114 | 5-110 | None |
| A0A3D9VRB1 | 11-101 | None |
| A0A838PBE7 | 2-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.