DPCstruct | MC63066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 16.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L6VIB0 | 1-91 | MPSFLLNTHLAVLSHLGLQVSRPDLDNSRQSLYNKAYRQAALKPFCQAAAGGVYGYMKIKKRYTKDLKLLIPAYNHYIHFLQKARYE… |
| A0A146HHY2 | 129-271 | RRDFTAEMNVMIRARKLRTDAALVNGDIATAITSIDTSLLAVAISMHVQVGLEHFRPDLLGGAPDDPYNMLHEISAIKSFTILLTTG… |
| A0A6A4GQP3 | 68-188 | None |
| F4RWI2 | 197-290 | None |
| A0A2N5V9H0 | 22-134 | None |
| A0A6A4GXQ1 | 11-126 | None |
| A0A0D7AV39 | 2-96 | None |
| A0A0L6UWG5 | 176-268 | None |
| A0A0L0UUA2 | 80-168 | None |
| A0A2N5UA29 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.