DPCstruct | MC63062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 383 ± 40 aa |
| Standard deviation of domain lengths | 39.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4RGY1 | 523-929 | SQELIPPMTQNQIEEIKEQLFKIPELVFLKYALNFDNKQKNIKINVTDVHFKYVQHKKFLVAKDSWLIPIHAFQDMFGDIEESHRRV… |
| A0A0L6V3X6 | 30-357 | KLATKNRKPVCYKQMEENYILEKFSEGQVSKWKRLGLNVFWIGTVSNQIRIDDKTPHKAIVYEPGEITCYNRLKDIWMNSASDMIKE… |
| H6QQB1 | 640-983 | None |
| A0A180GXM8 | 724-1070 | None |
| A0A2S4WNY8 | 426-849 | None |
| E3K9B5 | 49-423 | None |
| E3KZ43 | 18-380 | None |
| A0A2S4VAV1 | 1-360 | None |
| F4RGR4 | 675-1064 | None |
| A0A180GD75 | 751-1071 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.