DPCstruct | MC6306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1660 |
|---|---|
| Mean domain length (aa) | 253 ± 41 aa |
| Standard deviation of domain lengths | 41.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 12.78 |
| Pfam Score | 84.66 |
| Assigned Pfam label(s) | PF19527- CL0126- CL0672- CL0020- CL0056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A086JLR3 | 696-928 | NMVESGKVEGEKGRHFAVFEDPFQKPCYLFALVAGDLKSISQSFTTMSGRNVKVSIFSEPEDSSKLTWALESVLKSMKWDEERFGRE… |
| A0A485M593 | 35-283 | VLVLCLLAGTPQAQEYRVMDGPGIQVMYADPSLELSAREVIGRYPSIKEGLESVFLWEMDFHPRVLLVADRRSFIMMAGHEAYVAYA… |
| A0A7R9PQ32 | 224-485 | None |
| A0A1W1XF26 | 181-411 | None |
| A0A6B1GFU9 | 158-397 | None |
| K8EE20 | 12-422 | None |
| A0A1M5EPK2 | 782-982 | None |
| A0A212T4D1 | 21-240 | None |
| A0A1D1W7M0 | 255-552 | None |
| A0A7R9Q2B9 | 451-702 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.