DPCstruct | MC63053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 203 ± 37 aa |
| Standard deviation of domain lengths | 36.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 20.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179F0X9 | 5-197 | EPAFSAIATAATVDELIETIPAPYRPVLGPYIVKKYRIARSRTVTARTLSSYQRHMKRGTYPAAIRRSLMVPFLDVTNEFLASPQYA… |
| A0A175W4A5 | 11-214 | DSAIDTYLSNASSMTELIDLIPATYRAALSRILRGHFAMSQKISNCQQILATLNRHKSDGTFPQTVLAAIKQPNIQYSKEFMGGAGQ… |
| A0A067P1T1 | 21-214 | None |
| J4I3K3 | 84-301 | None |
| A0A0F8A308 | 9-194 | None |
| A0A0D2NW29 | 47-252 | None |
| A0A0C9U5M6 | 35-185 | None |
| A0A219ANL0 | 17-205 | None |
| A0A0C2WPY3 | 4-256 | None |
| A0A060SX00 | 39-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.