DPCstruct | MC6304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 177 ± 17 aa |
| Standard deviation of domain lengths | 17.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084TLW0 | 12-182 | EYGKWLEFHKLNHSDFSKFGNDVERKTEWYSFDLTKEYQNLFKPFRIYSSDSTYFIDLDSYSLVLERENEKLISHGSGVDMKVQVIR… |
| A0A485LZB4 | 44-200 | AALAAGLTLPGCSRQDSALLETPQVRFWKNFFFTEGAPIQDDGTMEFTCIPIPPPGHQPPGSGLVCNESDSVCLVIDTGYLQEQGRV… |
| A0A7L5FW45 | 1-143 | None |
| A0A1F4W015 | 220-408 | None |
| A0A1G6Z7X5 | 18-197 | None |
| A0A3D2F0T9 | 183-326 | None |
| A0A349D2X7 | 74-262 | None |
| A0A4Q1D5W1 | 35-212 | None |
| A0A496MD66 | 71-249 | None |
| A0A2G4GJJ5 | 41-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.