DPCstruct | MC63035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 105 ± 21 aa |
| Standard deviation of domain lengths | 21.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1DDB4 | 122-214 | KDACKLHMTWQEVRARRKAKQAFSGGLGEVQSIKYATDWNPREEYGVWTCIKDWDRQAQLECEAGAGILTCFKYDEVGKRFRFWGPN… |
| L1JPX1 | 403-478 | CQMQQTWDEIMEGIRRGNQTHKSGGLGDLMILNKFEVWVCSLRDACAKHNISFCYVFDEQKKMFVPWGLADELMLV |
| A0A7S0M6Q6 | 43-127 | None |
| A0A7S1H103 | 5-90 | None |
| L1I4A1 | 1043-1146 | None |
| L1I6U5 | 6-116 | None |
| L1IJF7 | 7-137 | None |
| L1IHM8 | 1-74 | None |
| A0A7S0HVB7 | 85-178 | None |
| A0A7S4PLJ3 | 70-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.