DPCstruct | MC63032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 167 ± 38 aa |
| Standard deviation of domain lengths | 37.82 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813UG30 | 220-366 | DNTIGQVKRILQEKGVLNDTLLVVTADHSHSFSFGAGSARGSNIFGFGTLDNANVSTVDKMPVHIITYSNGPNFAATRNKAYFDSID… |
| A0A812FQU4 | 1-235 | MVEGGQIDWAGHSNDAGTMLHELIKFDEAVNTVYEWAKGREDTLVIVTADHETGSFGFSYSSANLPKPEKRSGEAFANRDYVPNFNF… |
| A0A2B4SRT5 | 53-184 | None |
| A0A1V1VDB6 | 98-349 | None |
| W7Z717 | 54-244 | None |
| T1GX53 | 2-124 | None |
| A0A835CQU2 | 333-512 | None |
| A0A7D8HAC5 | 2-142 | None |
| A0A7R9NY00 | 286-449 | None |
| A0A1Y2HLC3 | 288-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.