DPCstruct | MC6303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 247 ± 44 aa |
| Standard deviation of domain lengths | 43.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4ILN3 | 23-293 | RVTVINIAGFLDFQAELVAGSLSSAGCTAHVAELTLPVLDVLRNNPSEFRAVNIARVLDLPENHRALVEELRLLLGSGEAMILPACL… |
| A0A485LZ97 | 10-269 | EYLHVISFQGIKDFFPGYITSRHRNSTYSVYDAGVPTTLGIAARFDDASFLDAFINWLRGLEIPHDRVALPAVLGTIDPASVVEKIS… |
| E8KIF2 | 14-234 | None |
| D1YXK8 | 106-308 | None |
| A0A832CN88 | 60-347 | None |
| A0A377LWC3 | 2-194 | None |
| T1H9V9 | 298-596 | None |
| A0A3S4L3C7 | 1-174 | None |
| A0A378CTN5 | 132-388 | None |
| A0A1F9FQ16 | 110-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.