DPCstruct | MC63021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 147 |
|---|---|
| Mean domain length (aa) | 119 ± 23 aa |
| Standard deviation of domain lengths | 22.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.53 |
| Pfam Score | 95.32 |
| Assigned Pfam label(s) | PF20624- PF12374- PF00751 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7RI10 | 1-74 | KYPRTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQLLYGTA |
| A0A4U8UPJ4 | 4-124 | NTPTAHHPYAFSGGVIDARERKPKCARCRNHGIVSWLKGHKRHCKFKNCACEKCNLIAERQRVMAAQVALKRKQAAEDAIALGLRVV… |
| A0A0D8YFG5 | 147-259 | None |
| A0A5N5TEN9 | 36-114 | None |
| A0A3Q4HNP7 | 8-139 | None |
| A0A7J6CTM5 | 213-310 | None |
| A0A0N5D2F7 | 26-133 | None |
| A0A4Y2CZN2 | 77-218 | None |
| T1KMJ4 | 4-115 | None |
| A0A183MBE7 | 95-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.