DPCstruct | MC63019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 309 ± 32 aa |
| Standard deviation of domain lengths | 32.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5I0Q1 | 666-978 | ADFRAPHYVLLLAILSGYFMYIFGKFACKILIQGFSYAFPVNLTIPVTISLLMAACGLRNADPCFFHGTIPDYLFFESPPMDFFKGL… |
| A0A4U8UJK7 | 13-345 | TSPYDALWMALIQILSVIVCYHSSKFACKVMMQRMGFALPIALAVPTTVFVLSHVCAKRTSNSCHMTSVLTKELFWKCPVGSTDTWI… |
| A0A820Y8V2 | 168-523 | None |
| A0A0R3QB68 | 2-275 | None |
| A0A7R9K6K9 | 146-467 | None |
| T1G2G4 | 2-320 | None |
| A0A7F5RHT3 | 3-247 | None |
| A0A2T7NFQ9 | 36-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.