DPCstruct | MC6301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 96.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06089 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6PLM2 | 488-564 | SEERHISRARNILTKIGAHEEDLQCGGHFPISKNVGHAWIKADFTPTAICSNCSGKHVGMIAGSKALGADVQTYHLP |
| A0A7Z1ZFV9 | 80-151 | HSGEPLHAETAAAMLRKAGQDAGCLECGTHWPSNAQATRDLARSGAEATALHNNCSGKHAGFVCTACALGVD |
| A0A553HTD7 | 495-573 | None |
| A0A1T3CUM5 | 84-152 | None |
| A0A4Q4U966 | 81-150 | None |
| A0A010RC88 | 84-165 | None |
| A0A0G4PFW5 | 323-404 | None |
| A0A812V4I8 | 96-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.