DPCstruct | MC63000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1GLJ5 | 6-136 | MDSIIAQGQRLATHSWEYGAFAEALLEWYDPFYSVFANDPFPDGKIPVANVDDVRSLSYVKPFISINSTTLVDGDGAAGDPASLGVS… |
| A0A1X7RK19 | 14-176 | LSTAHAQTSHSSCCDLNPGYDPIKVANQAIRLATHSWEYGTLSEALLQLYSPELSVFSPSAFPHGSLPAPDVSSTVGLNYALPHISL… |
| A0A4Y9Y3G1 | 142-314 | None |
| A0A166EI32 | 13-179 | None |
| A0A0G4LI96 | 2-122 | None |
| A0A0A1TDW7 | 2-158 | None |
| A0A146I6W1 | 6-163 | None |
| A0A0C4EZH0 | 102-277 | None |
| A0A166D632 | 5-181 | None |
| A0A094DK56 | 1-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.