DPCstruct | MC6300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 18.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 95.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7S7H3 | 216-297 | EMALVKLYMVTGDKKYLDQAKFFLDTRGYTSRKDAYSQAHKPVVEQDEAVGHAVRAVYMYSGMADVAAITGDSSYIKAIDKI |
| L0EAI1 | 185-311 | ELALVRLYGATGEEGYLWLAKFFVDERGKEPNYFLEEWKRGRPPIWGSGKPNLEYNQAHLPVREQTAAVGHAVRAVYLYSAMADLAR… |
| A0A645A6U3 | 48-164 | None |
| A0A0N0I737 | 184-321 | None |
| A0A8A3PI57 | 93-233 | None |
| X0PHH3 | 202-333 | None |
| A0A2V9QLK8 | 251-360 | None |
| A0A4R0RYS3 | 224-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.