DPCstruct | MC63
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 2.93 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 78.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7RCU4 | 128-182 | PVQLSKFLGRDKDDGARRSAVSGKKILLKLEKTKEDKTAENNRNELLKFLNASYD |
| A0A164VKQ9 | 2-58 | ASKLELPSFLGRDKDDSVRRSAVSGKKILLTRDKLKEDKVAENNRNQLLKFLNSSCN |
| A0A0P0YBD6 | 13-70 | None |
| A0A804RAZ8 | 102-158 | None |
| A0A178UDY5 | 12-63 | None |
| A0A061FAM8 | 131-187 | None |
| A0A4S4F2A6 | 111-166 | None |
| A0A3Q7EPZ2 | 78-133 | None |
| A0A4D9B0U0 | 205-266 | None |
| A0A7J8P5W7 | 56-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.