DPCstruct | MC62999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433ULD1 | 86-150 | QPIKIDPLDEKKLAFRLSTTVSTLTEKRNTLSAKEFEAWTRDKDNVKRGWRYDEKEGLYHEVNAT |
| A0A2K3CAK4 | 5-83 | LPKNDGGEKQQPSKPINHSDPSGLSARSLSKRLGVDRKTLTRWKEKGNEILIERSRDRDPEGKAWVFDEESKMYLEESN |
| K9WRF4 | 179-300 | None |
| A0A6B3NDF7 | 132-210 | None |
| B2JBV2 | 141-216 | None |
| A0A1U7HB46 | 149-256 | None |
| A0A846CYI7 | 34-113 | None |
| A0A845WDD0 | 413-482 | None |
| A0A352AAT5 | 130-203 | None |
| A0A2K8WM38 | 207-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.