DPCstruct | MC62992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 222 ± 29 aa |
| Standard deviation of domain lengths | 28.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 44.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1TER5 | 2-238 | RWCIRAARAGIENLVIPDEKAIEKAYKSARAADGGSATRSPVKDQTGNVVNWRVGELEWEAWMRVLDHAGFRTGHIYRQPSLRPKSA… |
| A0A1S0TG49 | 1-169 | MRVLDNAGYRTGHIYRQPLFRSRTLPSSTNQNDVAVPPSASSIGTVDESDYESVTAHKMALLRKEQERSRWLNSPNAYQKIEILETG… |
| A0A0S7KEQ0 | 2-172 | None |
| A0A817YPU0 | 12-291 | None |
| A0A4Z2B2L5 | 1-198 | None |
| A0A7J7J0W0 | 24-217 | None |
| A0A2K5ZSY7 | 9-219 | None |
| A0A0K8U8P5 | 12-231 | None |
| A0A1V4KSP0 | 126-381 | None |
| L5KUX6 | 65-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.