DPCstruct | MC62986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 222 ± 33 aa |
| Standard deviation of domain lengths | 32.91 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1TAI0 | 1-227 | MSDFDKLDYMELSVVALDKEIQMPAGDARNPWSSVSTCKASLQLHFSTPMLFSYGMWRRLERHLARPAAVKENVNLYRYMSGFKFEE… |
| A0A2K6USB7 | 219-439 | SITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYVPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFL… |
| A0A3N4JE89 | 85-349 | None |
| A0A3Q0KNR3 | 323-572 | None |
| A0A369S705 | 328-538 | None |
| M3CJL5 | 156-411 | None |
| A0A2H2I8P3 | 255-432 | None |
| A0A2H2IBT2 | 61-280 | None |
| A0A067CNH5 | 266-552 | None |
| A0A556TJM3 | 136-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.