DPCstruct | MC6298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 275 |
|---|---|
| Mean domain length (aa) | 137 ± 21 aa |
| Standard deviation of domain lengths | 21.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0690 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6A6P2 | 344-438 | IDPIAALRGDIKKLNKLGTDDVNIVFANMIRAGLGILGSLAVLMIIYGGALWMTAAGNAERESKGLQTLIWAGLGVVVIFASYAILD… |
| A0A2M6XVD7 | 5-135 | KRKILLTLLTLLLLLPNISSAALKLNLDYPKFGGFDLKVNQDLNQIVAWFYYFIIAVAGIAAFAMLVWGGVEWMTSAGSPARISSAK… |
| A0A7C1HBS1 | 2-137 | None |
| A0A1F5AYQ7 | 8-146 | None |
| A0A7C1DCY4 | 4-173 | None |
| A0A7C1D8Q7 | 6-156 | None |
| A0A6G0A056 | 4-142 | None |
| A0A7T5REN7 | 2-158 | None |
| A0A2G9YE82 | 6-116 | None |
| A0A7Y4QDQ7 | 15-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.