DPCstruct | MC62975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1SQ88 | 1-114 | MGALEQFSLDVMQCEMFTARCPVPGFDHNTLPMTFAHLRQLLELVMSNDWTSYLAEYGQENGTYVRVSPSTATQLLEKIIEFEKKST… |
| Q5D9Q5 | 19-161 | SVVKHIARLLYDVLFGSQVRSLTETGFQQLSIDLSLCESFARSQPVPGLDRTTLWLIFADLRQLLDLYHKDDWTSYIAFRKRVDGSG… |
| A0A7T8QVG7 | 1-87 | None |
| A0A654I3J2 | 213-340 | None |
| A0A3P7D504 | 505-644 | None |
| A0A3Q0DRZ0 | 31-146 | None |
| A0A814K1K6 | 65-182 | None |
| A0A817EBX1 | 641-780 | None |
| A0A5B7G694 | 3-81 | None |
| A0A3Q2YGG1 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.